PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02621.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 143aa    MW: 16166.5 Da    PI: 11.7178
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02621.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.91.3e-112292956
                                  HHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox 29 ereeLAkklgLterqVkvWFqNrRakek 56
                                  ++ +LA++l+L  rqV vWFqNrRa+ k
  Zpz_sc02621.1.g00010.1.sm.mk  2 QKNDLARRLNLRPRQVEVWFQNRRARTK 29
                                  6789**********************98 PP

2HD-ZIP_I/II80.13.6e-262642891
                   HD-ZIP_I/II 28 rKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91
                                  +K++lar+L+l+prqv+vWFqnrRARtk+kq+E+  e+Lkr++ +l++en+rL++ev+eLr +l
  Zpz_sc02621.1.g00010.1.sm.mk  2 QKNDLARRLNLRPRQVEVWFQNRRARTKLKQTEVHREYLKRWCATLTQENRRLQREVAELR-AL 64
                                  8***********************************************************9.44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.216131IPR001356Homeobox domain
CDDcd000868.03E-8232No hitNo description
SuperFamilySSF466892.13E-9240IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-10229IPR009057Homeodomain-like
PfamPF000464.6E-9229IPR001356Homeobox domain
PROSITE patternPS000270629IPR017970Homeobox, conserved site
CDDcd146860.00182465No hitNo description
SMARTSM003403.1E-193174IPR003106Leucine zipper, homeobox-associated
PfamPF021834.1E-73164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
NQKNDLARRL NLRPRQVEVW FQNRRARTKL KQTEVHREYL KRWCATLTQE NRRLQREVAE  60
LRALRTTYPI YYGQPAAGFS SGATRGCPWC GNMAAPYPVI TALSSSVVAA PPPSVSALFA  120
SSRPFLGPFT VHPVLRRQPS ATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12331RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.11e-55PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6743e-41HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLK3YZM64e-56K3YZM6_SETIT; Uncharacterized protein
STRINGSi019736m1e-55(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-33homeobox from Arabidopsis thaliana